Lineage for d1qnzl1 (1qnz L:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741155Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 2741194Domain d1qnzl1: 1qnz L:1-111 [20448]
    Other proteins in same PDB: d1qnzh_, d1qnzl2
    part of anti-HIV Fv 0.5B

Details for d1qnzl1

PDB Entry: 1qnz (more details)

PDB Description: nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide
PDB Compounds: (L:) 0.5b antibody (light chain)

SCOPe Domain Sequences for d1qnzl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnzl1 b.1.1.1 (L:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsrtdftlnihpveeedaatyycqqsnedpftfgsgtkleik

SCOPe Domain Coordinates for d1qnzl1:

Click to download the PDB-style file with coordinates for d1qnzl1.
(The format of our PDB-style files is described here.)

Timeline for d1qnzl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qnzl2
View in 3D
Domains from other chains:
(mouse over for more information)
d1qnzh_