SCOPe 2.08: Domain d2h06a2: 2h06 A:161-313

Lineage for d2h06a2 (2h06 A:161-313)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)

8. Domain d2h06a2: 2h06 A:161-313 [204478]
   automated match to d2c4ka2
   complexed with so4

Details for d2h06a2

PDB Entry: 2h06, 2.2 Å

PDB Description: Crystal structure of human phosphoribosyl pyrophosphate synthetase 1

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase I

SCOPe Domain Sequences for d2h06a2:

Sequence, based on SEQRES records:

>d2h06a2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerkkanevdrmvlvgdvkdrvailvd
dmadtcgtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedk
mkhcskiqvidismilaeairrthngesvsylf

Sequence, based on observed residues (ATOM records):

>d2h06a2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerdrmvlvgdvkdrvailvddmadtc
gtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedkmkhcsk
iqvidismilaeairrthngesvsylf

Timeline for d2h06a2:

• d2h06a2 first appeared in SCOPe 2.03
  
• d2h06a2 appears in SCOPe 2.07