Lineage for d2h06a2 (2h06 A:161-313)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891980Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)
  8. 2891984Domain d2h06a2: 2h06 A:161-313 [204478]
    automated match to d2c4ka2
    complexed with so4

Details for d2h06a2

PDB Entry: 2h06 (more details), 2.2 Å

PDB Description: Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase I

SCOPe Domain Sequences for d2h06a2:

Sequence, based on SEQRES records: (download)

>d2h06a2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerkkanevdrmvlvgdvkdrvailvd
dmadtcgtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedk
mkhcskiqvidismilaeairrthngesvsylf

Sequence, based on observed residues (ATOM records): (download)

>d2h06a2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerdrmvlvgdvkdrvailvddmadtc
gtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedkmkhcsk
iqvidismilaeairrthngesvsylf

SCOPe Domain Coordinates for d2h06a2:

Click to download the PDB-style file with coordinates for d2h06a2.
(The format of our PDB-style files is described here.)

Timeline for d2h06a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h06a1