SCOPe 2.08: Domain d2gxsb_: 2gxs B:

Lineage for d2gxsb_ (2gxs B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [187453] (15 PDB entries)

8. Domain d2gxsb_: 2gxs B: [204475]
   automated match to d1q0ua_
   protein/RNA complex; complexed with amp, ca, gol

Details for d2gxsb_

PDB Entry: 2gxs, 1.66 Å

PDB Description: hera n-terminal domain in complex with amp, crystal form 2

PDB Compounds: (B:) heat resistant RNA dependent ATPase

SCOPe Domain Sequences for d2gxsb_:

Sequence; same for both SEQRES and ATOM records:

>d2gxsb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
mefkdfplkpeilealhgrglttptpiqaaalplalegkdligqartgtgktlafalpia
erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
fsatlpswakrlaerymknpvlinvik

Timeline for d2gxsb_:

• d2gxsb_ first appeared in SCOPe 2.03
  
• d2gxsb_ appears in SCOPe 2.07