SCOP 1.63: Domain d1deef1: 1dee F:2501-2621

Lineage for d1deef1 (1dee F:2501-2621)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab of human IgM RF 2A2 [48896] (2 PDB entries)

8. Domain d1deef1: 1dee F:2501-2621 [20447]
   Other proteins in same PDB: d1deea2, d1deeb2, d1deec2, d1deed2, d1deee2, d1deef2, d1deeg_, d1deeh_

Details for d1deef1

PDB Entry: 1dee, 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deef1:

Sequence; same for both SEQRES and ATOM records:

>d1deef1 b.1.1.1 (F:2501-2621) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2}
qvqlvesgggvvqpgkslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
s

Timeline for d1deef1:

• d1deef1 first appeared (with stable ids) in SCOP 1.55
  
• d1deef1 appears in SCOP 1.61
  
• d1deef1 appears in SCOP 1.65
  
• d1deef1 appears in the current release, SCOPe 2.08