![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.2: Rotavirus NSP2 fragment, C-terminal domain [75347] (2 families) ![]() |
![]() | Family d.13.2.0: automated matches [227188] (1 protein) not a true family |
![]() | Protein automated matches [226910] (1 species) not a true protein |
![]() | Species Rotavirus c [TaxId:10943] [225139] (1 PDB entry) |
![]() | Domain d2gu0b2: 2gu0 B:144-309 [204469] Other proteins in same PDB: d2gu0a1, d2gu0b1 automated match to d2r7ja1 |
PDB Entry: 2gu0 (more details), 2.8 Å
SCOPe Domain Sequences for d2gu0b2:
Sequence, based on SEQRES records: (download)
>d2gu0b2 d.13.2.0 (B:144-309) automated matches {Rotavirus c [TaxId: 10943]} netettpltesndivyqdsyftitkldysnhkllplmadeykitintktdipdrnqtafa ayirynfnkfaaishgkrhwrlvlhsqlmshaerldrkiksdkkhgrqfsyddgdmafvh pgwktcigqlcggttfevaktslysikpsktvrtatnkiesdlism
>d2gu0b2 d.13.2.0 (B:144-309) automated matches {Rotavirus c [TaxId: 10943]} netettpltesndivyqdsyftitkldysnhkllplmadeykitintktdipdrnqtafa ayirynfnkfaaishgkrhwrlvlhsqlmshaerldrkiksdkyddgdmafvhpgwktci gqlcggttfevaktslysikpsktvrtatnkiesdlism
Timeline for d2gu0b2: