Lineage for d2gu0b2 (2gu0 B:144-309)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2930045Superfamily d.13.2: Rotavirus NSP2 fragment, C-terminal domain [75347] (2 families) (S)
  5. 2930054Family d.13.2.0: automated matches [227188] (1 protein)
    not a true family
  6. 2930055Protein automated matches [226910] (1 species)
    not a true protein
  7. 2930056Species Rotavirus c [TaxId:10943] [225139] (1 PDB entry)
  8. 2930058Domain d2gu0b2: 2gu0 B:144-309 [204469]
    Other proteins in same PDB: d2gu0a1, d2gu0b1
    automated match to d2r7ja1

Details for d2gu0b2

PDB Entry: 2gu0 (more details), 2.8 Å

PDB Description: Crystal Structure of Human Rotavirus NSP2 (Group C / Bristol Strain)
PDB Compounds: (B:) Nonstructural protein 2

SCOPe Domain Sequences for d2gu0b2:

Sequence, based on SEQRES records: (download)

>d2gu0b2 d.13.2.0 (B:144-309) automated matches {Rotavirus c [TaxId: 10943]}
netettpltesndivyqdsyftitkldysnhkllplmadeykitintktdipdrnqtafa
ayirynfnkfaaishgkrhwrlvlhsqlmshaerldrkiksdkkhgrqfsyddgdmafvh
pgwktcigqlcggttfevaktslysikpsktvrtatnkiesdlism

Sequence, based on observed residues (ATOM records): (download)

>d2gu0b2 d.13.2.0 (B:144-309) automated matches {Rotavirus c [TaxId: 10943]}
netettpltesndivyqdsyftitkldysnhkllplmadeykitintktdipdrnqtafa
ayirynfnkfaaishgkrhwrlvlhsqlmshaerldrkiksdkyddgdmafvhpgwktci
gqlcggttfevaktslysikpsktvrtatnkiesdlism

SCOPe Domain Coordinates for d2gu0b2:

Click to download the PDB-style file with coordinates for d2gu0b2.
(The format of our PDB-style files is described here.)

Timeline for d2gu0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gu0b1