| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily) consists of six alpha-helices and two beta-hairpins |
Superfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (2 families) ![]() |
| Family d.216.1.0: automated matches [227187] (1 protein) not a true family |
| Protein automated matches [226909] (1 species) not a true protein |
| Species Rotavirus c [TaxId:10943] [225138] (1 PDB entry) |
| Domain d2gu0b1: 2gu0 B:2-143 [204468] Other proteins in same PDB: d2gu0a2, d2gu0b2 automated match to d2r7ja2 |
PDB Entry: 2gu0 (more details), 2.8 Å
SCOPe Domain Sequences for d2gu0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gu0b1 d.216.1.0 (B:2-143) automated matches {Rotavirus c [TaxId: 10943]}
aelacfvsfsltedkvvwypinkkavqtmlcakvekdqrsnyydtilygvapppefrnrf
ktnerygldyesdqytelvnlladtlnmvsmptekfqfdivktvvqvrhlenllcrikdv
ndilnanvklrvkavmiacnlv
Timeline for d2gu0b1: