Lineage for d2gu0b1 (2gu0 B:2-143)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006833Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily)
    consists of six alpha-helices and two beta-hairpins
  4. 3006834Superfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (2 families) (S)
  5. 3006843Family d.216.1.0: automated matches [227187] (1 protein)
    not a true family
  6. 3006844Protein automated matches [226909] (1 species)
    not a true protein
  7. 3006845Species Rotavirus c [TaxId:10943] [225138] (1 PDB entry)
  8. 3006847Domain d2gu0b1: 2gu0 B:2-143 [204468]
    Other proteins in same PDB: d2gu0a2, d2gu0b2
    automated match to d2r7ja2

Details for d2gu0b1

PDB Entry: 2gu0 (more details), 2.8 Å

PDB Description: Crystal Structure of Human Rotavirus NSP2 (Group C / Bristol Strain)
PDB Compounds: (B:) Nonstructural protein 2

SCOPe Domain Sequences for d2gu0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gu0b1 d.216.1.0 (B:2-143) automated matches {Rotavirus c [TaxId: 10943]}
aelacfvsfsltedkvvwypinkkavqtmlcakvekdqrsnyydtilygvapppefrnrf
ktnerygldyesdqytelvnlladtlnmvsmptekfqfdivktvvqvrhlenllcrikdv
ndilnanvklrvkavmiacnlv

SCOPe Domain Coordinates for d2gu0b1:

Click to download the PDB-style file with coordinates for d2gu0b1.
(The format of our PDB-style files is described here.)

Timeline for d2gu0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gu0b2