Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily) consists of six alpha-helices and two beta-hairpins |
Superfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (2 families) |
Family d.216.1.0: automated matches [227187] (1 protein) not a true family |
Protein automated matches [226909] (1 species) not a true protein |
Species Rotavirus c [TaxId:10943] [225138] (1 PDB entry) |
Domain d2gu0a1: 2gu0 A:2-143 [204466] Other proteins in same PDB: d2gu0a2, d2gu0b2 automated match to d2r7ja2 |
PDB Entry: 2gu0 (more details), 2.8 Å
SCOPe Domain Sequences for d2gu0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gu0a1 d.216.1.0 (A:2-143) automated matches {Rotavirus c [TaxId: 10943]} aelacfvsfsltedkvvwypinkkavqtmlcakvekdqrsnyydtilygvapppefrnrf ktnerygldyesdqytelvnlladtlnmvsmptekfqfdivktvvqvrhlenllcrikdv ndilnanvklrvkavmiacnlv
Timeline for d2gu0a1: