SCOPe 2.07: Domain d2gsgd1: 2gsg D:2-118

Lineage for d2gsgd1 (2gsg D:2-118)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d2gsgd1: 2gsg D:2-118 [204465]
   Other proteins in same PDB: d2gsga_, d2gsgb2, d2gsgc_, d2gsgd2
   automated match to d1ar1c_
   complexed with so4

Details for d2gsgd1

PDB Entry: 2gsg, 2.1 Å

PDB Description: Crystal structure of the Fv fragment of a monoclonal antibody specific for poly-glutamine

PDB Compounds: (D:) monoclonal antibody heavy chain

SCOPe Domain Sequences for d2gsgd1:

Sequence; same for both SEQRES and ATOM records:

>d2gsgd1 b.1.1.1 (D:2-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqesggglvqpggslklscaasgftfrdyymywvrqtpekrlewvafisngggstyyp
dtvkgrftisrdnakntlylqmsrlksedtamyycargrgyvwfaywgqgttvtvss

Timeline for d2gsgd1:

• d2gsgd1 first appeared in SCOPe 2.03, called d2gsgd_
  
• d2gsgd1 was called d2gsgd_ in SCOPe 2.06
  
• d2gsgd1 appears in the current release, SCOPe 2.08