Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d2gsgd1: 2gsg D:2-118 [204465] Other proteins in same PDB: d2gsga_, d2gsgb2, d2gsgc_, d2gsgd2 automated match to d1ar1c_ complexed with so4 |
PDB Entry: 2gsg (more details), 2.1 Å
SCOPe Domain Sequences for d2gsgd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsgd1 b.1.1.1 (D:2-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vqlqesggglvqpggslklscaasgftfrdyymywvrqtpekrlewvafisngggstyyp dtvkgrftisrdnakntlylqmsrlksedtamyycargrgyvwfaywgqgttvtvss
Timeline for d2gsgd1:
View in 3D Domains from other chains: (mouse over for more information) d2gsga_, d2gsgb1, d2gsgb2, d2gsgc_ |