Lineage for d2gsgb1 (2gsg B:2-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744411Domain d2gsgb1: 2gsg B:2-118 [204463]
    Other proteins in same PDB: d2gsga_, d2gsgb2, d2gsgc_, d2gsgd2
    automated match to d1ar1c_
    complexed with so4

Details for d2gsgb1

PDB Entry: 2gsg (more details), 2.1 Å

PDB Description: Crystal structure of the Fv fragment of a monoclonal antibody specific for poly-glutamine
PDB Compounds: (B:) monoclonal antibody heavy chain

SCOPe Domain Sequences for d2gsgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsgb1 b.1.1.1 (B:2-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqesggglvqpggslklscaasgftfrdyymywvrqtpekrlewvafisngggstyyp
dtvkgrftisrdnakntlylqmsrlksedtamyycargrgyvwfaywgqgttvtvss

SCOPe Domain Coordinates for d2gsgb1:

Click to download the PDB-style file with coordinates for d2gsgb1.
(The format of our PDB-style files is described here.)

Timeline for d2gsgb1: