Lineage for d2gsga_ (2gsg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759833Domain d2gsga_: 2gsg A: [204462]
    Other proteins in same PDB: d2gsgb1, d2gsgb2, d2gsgd1, d2gsgd2
    automated match to d1mfal1
    complexed with so4

Details for d2gsga_

PDB Entry: 2gsg (more details), 2.1 Å

PDB Description: Crystal structure of the Fv fragment of a monoclonal antibody specific for poly-glutamine
PDB Compounds: (A:) monoclonal antibody light chain

SCOPe Domain Sequences for d2gsga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsga_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkyvmelkkdgshstgd
gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtv

SCOPe Domain Coordinates for d2gsga_:

Click to download the PDB-style file with coordinates for d2gsga_.
(The format of our PDB-style files is described here.)

Timeline for d2gsga_: