SCOP 1.65: Domain d1deee1: 1dee E:2001-2107

Lineage for d1deee1 (1dee E:2001-2107)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (16 PDB entries)
Domain d1deee1: 1dee E:2001-2107 [20446]
Other proteins in same PDB: d1deea2, d1deeb1, d1deeb2, d1deec2, d1deed1, d1deed2, d1deee2, d1deef1, d1deef2, d1deeg_, d1deeh_
part of IgM RF 2A2

Details for d1deee1

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deee1 b.1.1.1 (E:2001-2107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsysaprtfgqgtkveik

SCOP Domain Coordinates for d1deee1:

Click to download the PDB-style file with coordinates for d1deee1.
(The format of our PDB-style files is described here.)

Timeline for d1deee1: