Lineage for d2gr1a2 (2gr1 A:116-236)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833154Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1833376Protein NADH-dependent ferredoxin reductase, BphA4 [51957] (1 species)
  7. 1833377Species Pseudomonas sp., KKS102 [TaxId:306] [51958] (9 PDB entries)
  8. 1833387Domain d2gr1a2: 2gr1 A:116-236 [204456]
    Other proteins in same PDB: d2gr1a3
    automated match to d1d7ya2
    complexed with fad

Details for d2gr1a2

PDB Entry: 2gr1 (more details), 1.8 Å

PDB Description: Crystal structure of Ferredoxin reductase, BphA4 (hydroquinone)
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2gr1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gr1a2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
lptlqgatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslve
tqprlmsraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgi
g

SCOPe Domain Coordinates for d2gr1a2:

Click to download the PDB-style file with coordinates for d2gr1a2.
(The format of our PDB-style files is described here.)

Timeline for d2gr1a2: