| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
| Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
| Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species) |
| Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries) |
| Domain d2gqwa3: 2gqw A:309-400 [204451] Other proteins in same PDB: d2gqwa1, d2gqwa2, d2gqwa4 automated match to d1d7ya3 complexed with fad, fmt, gol |
PDB Entry: 2gqw (more details), 1.4 Å
SCOPe Domain Sequences for d2gqwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gqwa3 d.87.1.1 (A:309-400) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv
nnardfaplrrllavgakpdraaladpatdlr
Timeline for d2gqwa3: