Lineage for d1deed1 (1dee D:1501-1621)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219910Species Fab of human IgM RF 2A2 [48896] (2 PDB entries)
  8. 219914Domain d1deed1: 1dee D:1501-1621 [20445]
    Other proteins in same PDB: d1deea2, d1deeb2, d1deec2, d1deed2, d1deee2, d1deef2, d1deeg_, d1deeh_

Details for d1deed1

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab
PDB Compounds: (D:)

SCOP Domain Sequences for d1deed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deed1 b.1.1.1 (D:1501-1621) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2}
qvqlvesgggvvqpgkslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
s

SCOP Domain Coordinates for d1deed1:

Click to download the PDB-style file with coordinates for d1deed1.
(The format of our PDB-style files is described here.)

Timeline for d1deed1: