![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Beta-ketoacyl-ACP synthase II, C-terminal domain [419017] (6 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [419493] (1 PDB entry) |
![]() | Domain d2gqdb2: 2gqd B:253-414 [204448] Other proteins in same PDB: d2gqda1, d2gqdb1 automated match to d1ox0a2 |
PDB Entry: 2gqd (more details), 2.3 Å
SCOPe Domain Sequences for d2gqdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gqdb2 c.95.1.1 (B:253-414) Beta-ketoacyl-ACP synthase II, C-terminal domain {Staphylococcus aureus [TaxId: 1280]} niyaeivgygttgdayhitapapegeggsramqaamddagiepkdvqylnahgtstpvgd lnevkaikntfgeaakhlkvsstksmtghllgatggieaifsalsikdskvaptihavtp dpecdldivpneaqdldityamsnslgfgghnavlvfkkfea
Timeline for d2gqdb2: