SCOPe 2.08: Domain d2gqdb2: 2gqd B:253-414

Lineage for d2gqdb2 (2gqd B:253-414)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase II, C-terminal domain [419017] (6 species)

7. Species Staphylococcus aureus [TaxId:1280] [419493] (1 PDB entry)

8. Domain d2gqdb2: 2gqd B:253-414 [204448]
   Other proteins in same PDB: d2gqda1, d2gqdb1
   automated match to d1ox0a2

Details for d2gqdb2

PDB Entry: 2gqd, 2.3 Å

PDB Description: the crystal structure of b-ketoacyl-acp synthase ii (fabf) from staphylococcus aureus

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d2gqdb2:

Sequence; same for both SEQRES and ATOM records:

>d2gqdb2 c.95.1.1 (B:253-414) Beta-ketoacyl-ACP synthase II, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
niyaeivgygttgdayhitapapegeggsramqaamddagiepkdvqylnahgtstpvgd
lnevkaikntfgeaakhlkvsstksmtghllgatggieaifsalsikdskvaptihavtp
dpecdldivpneaqdldityamsnslgfgghnavlvfkkfea

Timeline for d2gqdb2:

• d2gqdb2 first appeared in SCOPe 2.03
  
• d2gqdb2 appears in SCOPe 2.07