Lineage for d2gqdb1 (2gqd B:4-252)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916692Protein Beta-ketoacyl-ACP synthase II, N-terminal domain [419016] (6 species)
  7. 2916709Species Staphylococcus aureus [TaxId:1280] [419492] (1 PDB entry)
  8. 2916711Domain d2gqdb1: 2gqd B:4-252 [204447]
    Other proteins in same PDB: d2gqda2, d2gqdb2
    automated match to d1ox0a1
    has additional insertions and/or extensions that are not grouped together

Details for d2gqdb1

PDB Entry: 2gqd (more details), 2.3 Å

PDB Description: the crystal structure of b-ketoacyl-acp synthase ii (fabf) from staphylococcus aureus
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d2gqdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gqdb1 c.95.1.1 (B:4-252) Beta-ketoacyl-ACP synthase II, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
nkrvvitgmgalspigndvkttwenalkgvngidkitridtepysvhlagelknfniedh
idkkearrmdrftqyaivaareavkdaqldinentadrigvwigsgiggmetfeiahkql
mdkgprrvspffvpmlipdmatgqvsidlgakgpngatvtacatgtnsigeafkivqrgd
adamitggteapithmaiagfsasralstnddietacrpfqegrdgfvmgegagilvies
lesaqarga

SCOPe Domain Coordinates for d2gqdb1:

Click to download the PDB-style file with coordinates for d2gqdb1.
(The format of our PDB-style files is described here.)

Timeline for d2gqdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gqdb2