Lineage for d1deec1 (1dee C:1001-1107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287780Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (16 PDB entries)
  8. 287808Domain d1deec1: 1dee C:1001-1107 [20444]
    Other proteins in same PDB: d1deea2, d1deeb1, d1deeb2, d1deec2, d1deed1, d1deed2, d1deee2, d1deef1, d1deef2, d1deeg_, d1deeh_

Details for d1deec1

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deec1 b.1.1.1 (C:1001-1107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsysaprtfgqgtkveik

SCOP Domain Coordinates for d1deec1:

Click to download the PDB-style file with coordinates for d1deec1.
(The format of our PDB-style files is described here.)

Timeline for d1deec1: