SCOP 1.57: Domain d1deec1: 1dee C:1001-1107

Lineage for d1deec1 (1dee C:1001-1107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab of human IgM RF 2A2 [48896] (2 PDB entries)

8. Domain d1deec1: 1dee C:1001-1107 [20444]
   Other proteins in same PDB: d1deea2, d1deeb2, d1deec2, d1deed2, d1deee2, d1deef2, d1deeg_, d1deeh_

Details for d1deec1

PDB Entry: 1dee, 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deec1:

Sequence; same for both SEQRES and ATOM records:

>d1deec1 b.1.1.1 (C:1001-1107) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2}
diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsysaprtfgqgtkveik

Timeline for d1deec1:

• d1deec1 first appeared (with stable ids) in SCOP 1.55
  
• d1deec1 appears in SCOP 1.59
  
• d1deec1 appears in the current release, SCOPe 2.08