SCOPe 2.08: Domain d2gp6a2: 2gp6 A:260-417

Lineage for d2gp6a2 (2gp6 A:260-417)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196910] (13 PDB entries)

8. Domain d2gp6a2: 2gp6 A:260-417 [204435]
   Other proteins in same PDB: d2gp6a3, d2gp6b3
   automated match to d1ox0a2

Details for d2gp6a2

PDB Entry: 2gp6, 2.4 Å

PDB Description: x-ray crystal structure of mycobacterium tuberculosis beta-ketoacyl acyl carrier protein synthase ii (mtkasb)

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d2gp6a2:

Sequence; same for both SEQRES and ATOM records:

>d2gp6a2 c.95.1.0 (A:260-417) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
nilarimgasitsdgfhmvapdpngeraghaitraiqlaglapgdidhvnahatgtqvgd
laegrainnalggnrpavyapksalghsvgavgavesiltvlalrdqvipptlnlvnldp
eidldvvageprpgnyryainnsfgfgghnvaiafgry

Timeline for d2gp6a2:

• d2gp6a2 first appeared in SCOPe 2.03
  
• d2gp6a2 appears in SCOPe 2.07