SCOPe 2.05: Domain d2gojb2: 2goj B:83-195

Lineage for d2gojb2 (2goj B:83-195)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (30 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:137071] [225302] (1 PDB entry)

8. Domain d2gojb2: 2goj B:83-195 [204433]
   Other proteins in same PDB: d2goja1, d2gojb1
   automated match to d1gv3a2
   complexed with fe2

Details for d2gojb2

PDB Entry: 2goj, 2 Å

PDB Description: The crystal structure of the enzyme Fe-superoxide dismutase from Plasmodium falciparum

PDB Compounds: (B:) fe-superoxide dismutase

SCOPe Domain Sequences for d2gojb2:

Sequence; same for both SEQRES and ATOM records:

>d2gojb2 d.44.1.0 (B:83-195) automated matches {Plasmodium falciparum [TaxId: 137071]}
dcggephgeikekiqedfgsfnnfkeqfsnilcghfgsgwgwlalnnnnklvilqthdag
npikdntgipiltcdiwehayyidyrndrasyvkawwnlvnwnfanenlkkam

Timeline for d2gojb2:

• d2gojb2 first appeared in SCOPe 2.03
  
• d2gojb2 appears in SCOPe 2.04
  
• d2gojb2 appears in SCOPe 2.06
  
• d2gojb2 appears in the current release, SCOPe 2.08