Lineage for d1deeb1 (1dee B:501-621)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021762Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2021805Domain d1deeb1: 1dee B:501-621 [20443]
    Other proteins in same PDB: d1deea1, d1deea2, d1deeb2, d1deec1, d1deec2, d1deed2, d1deee1, d1deee2, d1deef2, d1deeg_, d1deeh_
    part of IgM RF 2A2

Details for d1deeb1

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab
PDB Compounds: (B:) igm rf 2a2

SCOPe Domain Sequences for d1deeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deeb1 b.1.1.1 (B:501-621) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qvqlvesgggvvqpgkslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
s

SCOPe Domain Coordinates for d1deeb1:

Click to download the PDB-style file with coordinates for d1deeb1.
(The format of our PDB-style files is described here.)

Timeline for d1deeb1: