Lineage for d2gncb1 (2gnc B:9-60)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377691Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)
  8. 2377695Domain d2gncb1: 2gnc B:9-60 [204428]
    Other proteins in same PDB: d2gnca2, d2gncb2
    automated match to d2xmfa_

Details for d2gncb1

PDB Entry: 2gnc (more details), 1.8 Å

PDB Description: Crystal structure of srGAP1 SH3 domain in the slit-robo signaling pathway
PDB Compounds: (B:) SLIT-ROBO Rho GTPase-activating protein 1

SCOPe Domain Sequences for d2gncb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gncb1 b.34.2.0 (B:9-60) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aiakfdyvgrsarelsfkkgaslllyhrasedwwegrhngidglvphqyivv

SCOPe Domain Coordinates for d2gncb1:

Click to download the PDB-style file with coordinates for d2gncb1.
(The format of our PDB-style files is described here.)

Timeline for d2gncb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gncb2