Lineage for d2gnca_ (2gnc A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310427Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1310428Protein automated matches [190457] (7 species)
    not a true protein
  7. 1310516Species Mouse (Mus musculus) [TaxId:10090] [189303] (5 PDB entries)
  8. 1310519Domain d2gnca_: 2gnc A: [204427]
    automated match to d2xmfa_

Details for d2gnca_

PDB Entry: 2gnc (more details), 1.8 Å

PDB Description: Crystal structure of srGAP1 SH3 domain in the slit-robo signaling pathway
PDB Compounds: (A:) SLIT-ROBO Rho GTPase-activating protein 1

SCOPe Domain Sequences for d2gnca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gnca_ b.34.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pefaiakfdyvgrsarelsfkkgaslllyhrasedwwegrhngidglvphqyivv

SCOPe Domain Coordinates for d2gnca_:

Click to download the PDB-style file with coordinates for d2gnca_.
(The format of our PDB-style files is described here.)

Timeline for d2gnca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gncb_