SCOPe 2.08: Domain d2gnca1: 2gnc A:9-60

Lineage for d2gnca1 (2gnc A:9-60)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)

8. Domain d2gnca1: 2gnc A:9-60 [204427]
   Other proteins in same PDB: d2gnca2, d2gncb2
   automated match to d2xmfa_

Details for d2gnca1

PDB Entry: 2gnc, 1.8 Å

PDB Description: Crystal structure of srGAP1 SH3 domain in the slit-robo signaling pathway

PDB Compounds: (A:) SLIT-ROBO Rho GTPase-activating protein 1

SCOPe Domain Sequences for d2gnca1:

Sequence; same for both SEQRES and ATOM records:

>d2gnca1 b.34.2.0 (A:9-60) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aiakfdyvgrsarelsfkkgaslllyhrasedwwegrhngidglvphqyivv

Timeline for d2gnca1:

• d2gnca1 first appeared in SCOPe 2.03, called d2gnca_
  
• d2gnca1 appears in SCOPe 2.07