SCOPe 2.06: Domain d2glpf_: 2glp F:

Lineage for d2glpf_ (2glp F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.6: FabZ-like [110902] (1 protein)
   automatically mapped to Pfam PF07977

6. Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)

7. Species Helicobacter pylori [TaxId:210] [188573] (16 PDB entries)

8. Domain d2glpf_: 2glp F: [204422]
   automated match to d2gllf_
   complexed with bde, ben, cl

Details for d2glpf_

PDB Entry: 2glp, 2.42 Å

PDB Description: crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase(fabz) from helicobacter pylori complexed with compound 1

PDB Compounds: (F:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d2glpf_:

Sequence; same for both SEQRES and ATOM records:

>d2glpf_ d.38.1.6 (F:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvli
vegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhkg
miwqvggtaqvdgkvvaeaelkamiae

Timeline for d2glpf_:

• d2glpf_ first appeared in SCOPe 2.03
  
• d2glpf_ appears in SCOPe 2.05
  
• d2glpf_ appears in SCOPe 2.07
  
• d2glpf_ appears in the current release, SCOPe 2.08