![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.6: FabZ-like [110902] (1 protein) automatically mapped to Pfam PF07977 |
![]() | Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species) |
![]() | Species Helicobacter pylori [TaxId:210] [188573] (17 PDB entries) |
![]() | Domain d2glpc_: 2glp C: [204419] automated match to d2gllf_ complexed with bde, ben, cl |
PDB Entry: 2glp (more details), 2.42 Å
SCOPe Domain Sequences for d2glpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glpc_ d.38.1.6 (C:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]} qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh kgmiwqvggtaqvdgkvvaeaelkamiaere
Timeline for d2glpc_: