Lineage for d2glmf_ (2glm F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551122Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2551123Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2551124Species Helicobacter pylori [TaxId:210] [188573] (17 PDB entries)
  8. 2551184Domain d2glmf_: 2glm F: [204416]
    automated match to d2gllf_
    complexed with ben, cl, scb

Details for d2glmf_

PDB Entry: 2glm (more details), 2.6 Å

PDB Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(FabZ) from Helicobacter pylori complexed with Compound 2
PDB Compounds: (F:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d2glmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glmf_ d.38.1.6 (F:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvli
vegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhkg
miwqvggtaqvdgkvvaeaelkamiae

SCOPe Domain Coordinates for d2glmf_:

Click to download the PDB-style file with coordinates for d2glmf_.
(The format of our PDB-style files is described here.)

Timeline for d2glmf_: