| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.6: FabZ-like [110902] (1 protein) automatically mapped to Pfam PF07977 |
| Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species) |
| Species Helicobacter pylori [TaxId:210] [188573] (17 PDB entries) |
| Domain d2glmc_: 2glm C: [204413] automated match to d2gllf_ complexed with ben, cl, scb |
PDB Entry: 2glm (more details), 2.6 Å
SCOPe Domain Sequences for d2glmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glmc_ d.38.1.6 (C:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
kgmiwqvggtaqvdgkvvaeaelkamiaere
Timeline for d2glmc_: