SCOP 1.55: Domain d1dqdh1: 1dqd H:1-122

Lineage for d1dqdh1 (1dqd H:1-122)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab HGR-2 F6, (mouse), kappa L chain [48895] (1 PDB entry)

8. Domain d1dqdh1: 1dqd H:1-122 [20441]
   Other proteins in same PDB: d1dqdh2, d1dqdl2

Details for d1dqdh1

PDB Entry: 1dqd, 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor

SCOP Domain Sequences for d1dqdh1:

Sequence; same for both SEQRES and ATOM records:

>d1dqdh1 b.1.1.1 (H:1-122) Immunoglobulin (variable domains of L and H chains) {Fab HGR-2 F6, (mouse), kappa L chain}
evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
ss

Timeline for d1dqdh1:

• d1dqdh1 appears in SCOP 1.57
  
• d1dqdh1 appears in the current release, SCOPe 2.08