Lineage for d2gl6d2 (2gl6 D:138-415)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1430621Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1430622Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1430747Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 1430805Protein automated matches [226885] (3 species)
    not a true protein
  7. 1430806Species Human (Homo sapiens) [TaxId:9606] [225066] (4 PDB entries)
  8. 1430816Domain d2gl6d2: 2gl6 D:138-415 [204402]
    Other proteins in same PDB: d2gl6a1, d2gl6b1, d2gl6c1, d2gl6d1, d2gl6e1, d2gl6f1, d2gl6g1, d2gl6h1
    automated match to d1crka2
    complexed with adp, mg, unx

Details for d2gl6d2

PDB Entry: 2gl6 (more details), 2.3 Å

PDB Description: crystal structure of human sarcomeric mitochondrial creatine kinase
PDB Compounds: (D:) creatine kinase

SCOPe Domain Sequences for d2gl6d2:

Sequence, based on SEQRES records: (download)

>d2gl6d2 d.128.1.2 (D:138-415) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vmkhttdldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitale
glkgdlagryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydk
tfliwineedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltc
psnlgtglragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrig
rsevelvqividgvnylvdcekklergqdikvppplpq

Sequence, based on observed residues (ATOM records): (download)

>d2gl6d2 d.128.1.2 (D:138-415) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vmkhttdldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitale
glkgdlagryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydk
tfliwineedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltc
psnlgtglragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrig
rsevelvqividgvnylvdcekklkvppplpq

SCOPe Domain Coordinates for d2gl6d2:

Click to download the PDB-style file with coordinates for d2gl6d2.
(The format of our PDB-style files is described here.)

Timeline for d2gl6d2: