Lineage for d2gl6d1 (2gl6 D:48-137)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496408Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 1496409Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 1496468Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 1496469Protein automated matches [226884] (6 species)
    not a true protein
  7. 1496472Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)
  8. 1496482Domain d2gl6d1: 2gl6 D:48-137 [204401]
    Other proteins in same PDB: d2gl6a2, d2gl6b2, d2gl6c2, d2gl6d2, d2gl6e2, d2gl6f2, d2gl6g2, d2gl6h2
    automated match to d1crka1
    complexed with adp, mg, unx

Details for d2gl6d1

PDB Entry: 2gl6 (more details), 2.3 Å

PDB Description: crystal structure of human sarcomeric mitochondrial creatine kinase
PDB Compounds: (D:) creatine kinase

SCOPe Domain Sequences for d2gl6d1:

Sequence, based on SEQRES records: (download)

>d2gl6d1 a.83.1.0 (D:48-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfiktvg
mvagdeesyevfadlfdpviklrhngydpr

Sequence, based on observed residues (ATOM records): (download)

>d2gl6d1 a.83.1.0 (D:48-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpktvgmvagd
eesyevfadlfdpviklrhngydpr

SCOPe Domain Coordinates for d2gl6d1:

Click to download the PDB-style file with coordinates for d2gl6d1.
(The format of our PDB-style files is described here.)

Timeline for d2gl6d1: