Lineage for d1dqdl1 (1dqd L:1-106)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219779Species Fab HGR-2 F6, (mouse), kappa L chain [48895] (1 PDB entry)
    a competitive antagonist of the glucagon receptor
  8. 219781Domain d1dqdl1: 1dqd L:1-106 [20440]
    Other proteins in same PDB: d1dqdh2, d1dqdl2

Details for d1dqdl1

PDB Entry: 1dqd (more details), 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor

SCOP Domain Sequences for d1dqdl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqdl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab HGR-2 F6, (mouse), kappa L chain}
divlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleik

SCOP Domain Coordinates for d1dqdl1:

Click to download the PDB-style file with coordinates for d1dqdl1.
(The format of our PDB-style files is described here.)

Timeline for d1dqdl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqdl2