Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab HGR-2 F6, (mouse), kappa L chain [48895] (1 PDB entry) a competitive antagonist of the glucagon receptor |
Domain d1dqdl1: 1dqd L:1-106 [20440] Other proteins in same PDB: d1dqdh2, d1dqdl2 |
PDB Entry: 1dqd (more details), 2.1 Å
SCOP Domain Sequences for d1dqdl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqdl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab HGR-2 F6, (mouse), kappa L chain} divlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnlasgvpar fsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleik
Timeline for d1dqdl1: