Lineage for d1dqdl1 (1dqd L:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741215Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2741216Domain d1dqdl1: 1dqd L:1-106 [20440]
    Other proteins in same PDB: d1dqdh1, d1dqdh2, d1dqdl2
    part of Fab HGR-2 F6, a competitive antagonist of the glucagon receptor

Details for d1dqdl1

PDB Entry: 1dqd (more details), 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor
PDB Compounds: (L:) fab hgr-2 f6

SCOPe Domain Sequences for d1dqdl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqdl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleik

SCOPe Domain Coordinates for d1dqdl1:

Click to download the PDB-style file with coordinates for d1dqdl1.
(The format of our PDB-style files is described here.)

Timeline for d1dqdl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqdl2