SCOPe 2.08: Domain d1dqdl1: 1dqd L:1-106

Lineage for d1dqdl1 (1dqd L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d1dqdl1: 1dqd L:1-106 [20440]
   Other proteins in same PDB: d1dqdh1, d1dqdh2, d1dqdl2
   part of Fab HGR-2 F6, a competitive antagonist of the glucagon receptor

Details for d1dqdl1

PDB Entry: 1dqd, 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor

PDB Compounds: (L:) fab hgr-2 f6

SCOPe Domain Sequences for d1dqdl1:

Sequence; same for both SEQRES and ATOM records:

>d1dqdl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleik

Timeline for d1dqdl1:

• d1dqdl1 first appeared (with stable ids) in SCOP 1.55
  
• d1dqdl1 appears in SCOPe 2.07