SCOPe 2.03: Domain d2gkib2: 2gki B:159-274

Lineage for d2gkib2 (2gki B:159-274)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d2gkib2: 2gki B:159-274 [204394]
   automated match to d1nqba2

Details for d2gkib2

PDB Entry: 2gki, 2.88 Å

PDB Description: heavy and light chain variable single domains of an anti-dna binding antibody hydrolyze both double- and single-stranded dnas without sequence specificity

PDB Compounds: (B:) Nuclease

SCOPe Domain Sequences for d2gkib2:

Sequence; same for both SEQRES and ATOM records:

>d2gkib2 b.1.1.0 (B:159-274) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleikhhh

Timeline for d2gkib2:

• d2gkib2 is new in SCOPe 2.03-stable
  
• d2gkib2 appears in SCOPe 2.04
  
• d2gkib2 appears in the current release, SCOPe 2.08