Lineage for d2gkib1 (2gki B:23-132)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761161Domain d2gkib1: 2gki B:23-132 [204393]
    Other proteins in same PDB: d2gkia3, d2gkib3
    automated match to d1nqba1

Details for d2gkib1

PDB Entry: 2gki (more details), 2.88 Å

PDB Description: heavy and light chain variable single domains of an anti-dna binding antibody hydrolyze both double- and single-stranded dnas without sequence specificity
PDB Compounds: (B:) Nuclease

SCOPe Domain Sequences for d2gkib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkib1 b.1.1.0 (B:23-132) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycargaykrgyamdyw

SCOPe Domain Coordinates for d2gkib1:

Click to download the PDB-style file with coordinates for d2gkib1.
(The format of our PDB-style files is described here.)

Timeline for d2gkib1: