Lineage for d32c2b1 (32c2 B:1-119)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219464Species Fab 32C2 against P450-arom, (mouse), kappa L chain [48894] (1 PDB entry)
    activity suppressing
  8. 219466Domain d32c2b1: 32c2 B:1-119 [20439]
    Other proteins in same PDB: d32c2a2, d32c2b2

Details for d32c2b1

PDB Entry: 32c2 (more details), 3 Å

PDB Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase

SCOP Domain Sequences for d32c2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d32c2b1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Fab 32C2 against P450-arom, (mouse), kappa L chain}
dvqlqesgpglvkpsqslsltctvtgysissdyawnwirqfpgnklewmgyisysgstsy
npslksrisitrdtsknqfflqlssvttedtatyycargyygsshspvwgagttvtvss

SCOP Domain Coordinates for d32c2b1:

Click to download the PDB-style file with coordinates for d32c2b1.
(The format of our PDB-style files is described here.)

Timeline for d32c2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d32c2b2