| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab 32C2 against P450-arom, (mouse), kappa L chain [48894] (1 PDB entry) activity suppressing |
| Domain d32c2b1: 32c2 B:1-119 [20439] Other proteins in same PDB: d32c2a2, d32c2b2 |
PDB Entry: 32c2 (more details), 3 Å
SCOP Domain Sequences for d32c2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d32c2b1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Fab 32C2 against P450-arom, (mouse), kappa L chain}
dvqlqesgpglvkpsqslsltctvtgysissdyawnwirqfpgnklewmgyisysgstsy
npslksrisitrdtsknqfflqlssvttedtatyycargyygsshspvwgagttvtvss
Timeline for d32c2b1: