SCOP 1.63: Domain d32c2b1: 32c2 B:1-119

Lineage for d32c2b1 (32c2 B:1-119)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 32C2 against P450-arom, (mouse), kappa L chain [48894] (1 PDB entry)
   activity suppressing

8. Domain d32c2b1: 32c2 B:1-119 [20439]
   Other proteins in same PDB: d32c2a2, d32c2b2

Details for d32c2b1

PDB Entry: 32c2, 3 Å

PDB Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase

SCOP Domain Sequences for d32c2b1:

Sequence; same for both SEQRES and ATOM records:

>d32c2b1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Fab 32C2 against P450-arom, (mouse), kappa L chain}
dvqlqesgpglvkpsqslsltctvtgysissdyawnwirqfpgnklewmgyisysgstsy
npslksrisitrdtsknqfflqlssvttedtatyycargyygsshspvwgagttvtvss

Timeline for d32c2b1:

• d32c2b1 first appeared (with stable ids) in SCOP 1.55
  
• d32c2b1 appears in SCOP 1.61
  
• d32c2b1 appears in SCOP 1.65
  
• d32c2b1 appears in the current release, SCOPe 2.08