Lineage for d2gk0a2 (2gk0 A:109-212)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767168Domain d2gk0a2: 2gk0 A:109-212 [204387]
    Other proteins in same PDB: d2gk0a1, d2gk0l1
    automated match to d2jell2

Details for d2gk0a2

PDB Entry: 2gk0 (more details), 2.45 Å

PDB Description: Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2
PDB Compounds: (A:) Catalytic elimination antibody 13G5 light chain

SCOPe Domain Sequences for d2gk0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gk0a2 b.1.1.0 (A:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d2gk0a2:

Click to download the PDB-style file with coordinates for d2gk0a2.
(The format of our PDB-style files is described here.)

Timeline for d2gk0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gk0a1