SCOPe 2.08: Domain d2gk0a2: 2gk0 A:109-212

Lineage for d2gk0a2 (2gk0 A:109-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2gk0a2: 2gk0 A:109-212 [204387]
   Other proteins in same PDB: d2gk0a1, d2gk0b_, d2gk0h_, d2gk0l1
   automated match to d2jell2

Details for d2gk0a2

PDB Entry: 2gk0, 2.45 Å

PDB Description: Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2

PDB Compounds: (A:) Catalytic elimination antibody 13G5 light chain

SCOPe Domain Sequences for d2gk0a2:

Sequence; same for both SEQRES and ATOM records:

>d2gk0a2 b.1.1.0 (A:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d2gk0a2:

• d2gk0a2 first appeared in SCOPe 2.03
  
• d2gk0a2 appears in SCOPe 2.07