| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d2gjzl2: 2gjz L:109-212 [204385] Other proteins in same PDB: d2gjza1, d2gjzb_, d2gjzh_, d2gjzl1 automated match to d2jell2 complexed with zn |
PDB Entry: 2gjz (more details), 2.65 Å
SCOPe Domain Sequences for d2gjzl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjzl2 b.1.1.0 (L:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d2gjzl2:
View in 3DDomains from other chains: (mouse over for more information) d2gjza1, d2gjza2, d2gjzb_, d2gjzh_ |