Lineage for d2gjza2 (2gjz A:109-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760255Domain d2gjza2: 2gjz A:109-212 [204383]
    Other proteins in same PDB: d2gjza1, d2gjzb_, d2gjzh_, d2gjzl1
    automated match to d2jell2
    complexed with zn

Details for d2gjza2

PDB Entry: 2gjz (more details), 2.65 Å

PDB Description: Structure of Catalytic Elimination Antibody 13G5 from a crystal in space group P2(1)
PDB Compounds: (A:) Catalytic elimination antibody 13G5 light chain

SCOPe Domain Sequences for d2gjza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjza2 b.1.1.0 (A:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d2gjza2:

Click to download the PDB-style file with coordinates for d2gjza2.
(The format of our PDB-style files is described here.)

Timeline for d2gjza2: