SCOP 1.55: Domain d32c2a1: 32c2 A:1-110

Lineage for d32c2a1 (32c2 A:1-110)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 32C2 against P450-arom, (mouse), kappa L chain [48894] (1 PDB entry)

8. Domain d32c2a1: 32c2 A:1-110 [20438]
   Other proteins in same PDB: d32c2a2, d32c2b2

Details for d32c2a1

PDB Entry: 32c2, 3 Å

PDB Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase

SCOP Domain Sequences for d32c2a1:

Sequence; same for both SEQRES and ATOM records:

>d32c2a1 b.1.1.1 (A:1-110) Immunoglobulin (variable domains of L and H chains) {Fab 32C2 against P450-arom, (mouse), kappa L chain}
divltqspaslavslgqratiscrasksvstsgygymhwnqqkpgqpprlliylvsnles
gvparfsgsgsgtdftlnihpveeedaatyycqhirepltfgggtkleik

Timeline for d32c2a1:

• d32c2a1 appears in SCOP 1.57
  
• d32c2a1 appears in the current release, SCOPe 2.08