SCOPe 2.03: Domain d2giza1: 2giz A:6-164

Lineage for d2giza1 (2giz A:6-164)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.1: PR-1-like [55798] (5 proteins)
   Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1

6. Protein automated matches [194852] (3 species)
   not a true protein

7. Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries)

8. Domain d2giza1: 2giz A:6-164 [204374]
   Other proteins in same PDB: d2giza2, d2gizb2
   automated match to d1rc9a1

Details for d2giza1

PDB Entry: 2giz, 1.68 Å

PDB Description: Structural and functional analysis of Natrin, a member of crisp-3 family blocks a variety of ion channels

PDB Compounds: (A:) Natrin-1

SCOPe Domain Sequences for d2giza1:

Sequence; same for both SEQRES and ATOM records:

>d2giza1 d.111.1.1 (A:6-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
sestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnl
rvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqty
ragcavsycpssawsyfyvcqycpsgnfqgktatpyklg

Timeline for d2giza1:

• d2giza1 is new in SCOPe 2.03-stable
  
• d2giza1 appears in SCOPe 2.04
  
• d2giza1 appears in the current release, SCOPe 2.08