Lineage for d2gi7b2 (2gi7 B:89-183)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755714Domain d2gi7b2: 2gi7 B:89-183 [204373]
    Other proteins in same PDB: d2gi7b3
    automated match to d1ucta2
    complexed with cl, gol, so4

Details for d2gi7b2

PDB Entry: 2gi7 (more details), 2.4 Å

PDB Description: Crystal structure of human platelet Glycoprotein VI (GPVI)
PDB Compounds: (B:) GPVI protein

SCOPe Domain Sequences for d2gi7b2:

Sequence, based on SEQRES records: (download)

>d2gi7b2 b.1.1.0 (B:89-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvfakpslsaqpgpavssggdvtlqcqtrygfdqfalykegdpapyknperwyrasfpii
tvtaahsgtyrcysfssrdpylwsapsdplelvvt

Sequence, based on observed residues (ATOM records): (download)

>d2gi7b2 b.1.1.0 (B:89-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvfakpslsagdvtlqcqtrygfdqfalykegerwyrasfpiitvtaahsgtyrcysfss
rdpylwsapsdplelvvt

SCOPe Domain Coordinates for d2gi7b2:

Click to download the PDB-style file with coordinates for d2gi7b2.
(The format of our PDB-style files is described here.)

Timeline for d2gi7b2: