SCOPe 2.07: Domain d2gi7b1: 2gi7 B:1-88

Lineage for d2gi7b1 (2gi7 B:1-88)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2gi7b1: 2gi7 B:1-88 [204372]
   Other proteins in same PDB: d2gi7b3
   automated match to d1ucta1
   complexed with cl, gol, so4

Details for d2gi7b1

PDB Entry: 2gi7, 2.4 Å

PDB Description: Crystal structure of human platelet Glycoprotein VI (GPVI)

PDB Compounds: (B:) GPVI protein

SCOPe Domain Sequences for d2gi7b1:

Sequence; same for both SEQRES and ATOM records:

>d2gi7b1 b.1.1.0 (B:1-88) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamkr
slagryrcsyqngslwslpsdqlelvat

Timeline for d2gi7b1:

• d2gi7b1 first appeared in SCOPe 2.03
  
• d2gi7b1 appears in SCOPe 2.06
  
• d2gi7b1 appears in the current release, SCOPe 2.08