Lineage for d1qfwi_ (1qfw I:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510801Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1510873Domain d1qfwi_: 1qfw I: [20437]
    Other proteins in same PDB: d1qfwa_, d1qfwb_, d1qfwl_, d1qfwm_
    part of anti-[gonadotropin beta subunit] Fv
    complexed with nag

Details for d1qfwi_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit
PDB Compounds: (I:) antibody (anti beta subunit) (heavy chain)

SCOPe Domain Sequences for d1qfwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfwi_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
qvqlqesgghlvkpggslklscaasgfafssfdmswirqtpekrlewvasitnvgtytyy
pgsvkgrfsisrdnarntlnlqmsslrsedtalyfcarqgtaaqpywyfdvwgagttvtv
s

SCOPe Domain Coordinates for d1qfwi_:

Click to download the PDB-style file with coordinates for d1qfwi_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwi_: