SCOPe 2.07: Domain d2gh5b3: 2gh5 B:364-478

Lineage for d2gh5b3 (2gh5 B:364-478)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Glutathione reductase [55426] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries)

8. Domain d2gh5b3: 2gh5 B:364-478 [204368]
   Other proteins in same PDB: d2gh5a1, d2gh5a2, d2gh5b1, d2gh5b2
   automated match to d3grsa3
   complexed with eli, fad, gol, po4

Details for d2gh5b3

PDB Entry: 2gh5, 1.7 Å

PDB Description: Crystal Structure of human Glutathione Reductase complexed with a Fluoro-Analogue of the Menadione Derivative M5

PDB Compounds: (B:) glutathione reductase, mitochondrial

SCOPe Domain Sequences for d2gh5b3:

Sequence; same for both SEQRES and ATOM records:

>d2gh5b3 d.87.1.1 (B:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

Timeline for d2gh5b3:

• d2gh5b3 first appeared in SCOPe 2.03
  
• d2gh5b3 appears in SCOPe 2.06
  
• d2gh5b3 appears in the current release, SCOPe 2.08