Lineage for d2gh5a1 (2gh5 A:18-165,A:291-363)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2458195Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2458283Protein Glutathione reductase [51944] (3 species)
  7. 2458301Species Human (Homo sapiens) [TaxId:9606] [51945] (23 PDB entries)
  8. 2458316Domain d2gh5a1: 2gh5 A:18-165,A:291-363 [204363]
    Other proteins in same PDB: d2gh5a3, d2gh5b3
    automated match to d3grsa1
    complexed with eli, fad, gol, po4

Details for d2gh5a1

PDB Entry: 2gh5 (more details), 1.7 Å

PDB Description: Crystal Structure of human Glutathione Reductase complexed with a Fluoro-Analogue of the Menadione Derivative M5
PDB Compounds: (A:) glutathione reductase, mitochondrial

SCOPe Domain Sequences for d2gh5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gh5a1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
vasydylvigggsgglasarraaelgaraavveshklggtcvnvgcvpkkvmwntavhse
fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk
ptievsgkkytaphiliatggmpstpheXrvpntkdlslnklgiqtddkghiivdefqnt
nvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskld

SCOPe Domain Coordinates for d2gh5a1:

Click to download the PDB-style file with coordinates for d2gh5a1.
(The format of our PDB-style files is described here.)

Timeline for d2gh5a1: