Lineage for d2gf2b2 (2gf2 B:202-332)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003567Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2003568Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2003777Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2003778Protein automated matches [226851] (33 species)
    not a true protein
  7. 2003852Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries)
  8. 2003867Domain d2gf2b2: 2gf2 B:202-332 [204360]
    Other proteins in same PDB: d2gf2a1, d2gf2a3, d2gf2b1, d2gf2b3, d2gf2c1, d2gf2d1
    automated match to d2cvza1

Details for d2gf2b2

PDB Entry: 2gf2 (more details), 2.38 Å

PDB Description: Crystal structure of human hydroxyisobutyrate dehydrogenase
PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2gf2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf2b2 a.100.1.0 (B:202-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdtynpvp
gvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakgyskk
dfssvfqflre

SCOPe Domain Coordinates for d2gf2b2:

Click to download the PDB-style file with coordinates for d2gf2b2.
(The format of our PDB-style files is described here.)

Timeline for d2gf2b2: