SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2gf2b2 (2gf2 B:202-332)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003567Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2003568Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2003777Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2003778Protein automated matches [226851] (33 species)
    not a true protein
  7. 2003852Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries)
  8. 2003867Domain d2gf2b2: 2gf2 B:202-332 [204360]
    Other proteins in same PDB: d2gf2a1, d2gf2a3, d2gf2b1, d2gf2b3, d2gf2c1, d2gf2d1
    automated match to d2cvza1

Details for d2gf2b2

PDB Entry: 2gf2 (more details), 2.38 Å

PDB Description: Crystal structure of human hydroxyisobutyrate dehydrogenase
PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2gf2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf2b2 a.100.1.0 (B:202-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdtynpvp
gvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakgyskk
dfssvfqflre

SCOPe Domain Coordinates for d2gf2b2:

Click to download the PDB-style file with coordinates for d2gf2b2.
(The format of our PDB-style files is described here.)

Timeline for d2gf2b2: